PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S02617.40
Common NameGRAS41, JCGZ_19527, LOC105642420
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family GRAS
Protein Properties Length: 585aa    MW: 66224.1 Da    PI: 4.7966
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S02617.40genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS302.78.9e-932155834374
           GRAS   4 lLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetsekn..sseelaalklfsevsPilkfshl 96 
                     Ll+ Ae + ++++ +a +lL++    as+ g+p+qR++ yf+eAL++r+ + +++++ k l  +++ + +  + +   a+ + +++ P+ +++++
  Jcr4S02617.40 215 SLLASAENIGNQQFDRAGRLLKQCDLFASNIGNPVQRVVYYFVEALRERIDKeTGKTTLKGLGKKQSFDIDeaMMTPNLAVMASHQLMPFGQIAQF 310
                    58999***********************************************788888888866666543334444445555699*********** PP

           GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlel 191
                    +  qaI e v +++r+HiiD+ i +G+QW  L+qaL sR e p   l+iT+++    +s+  +++tg+ L++fAe++++pf+fn++ ++++++++ 
  Jcr4S02617.40 311 AGIQAIEENVGNAKRIHIIDLAIRNGIQWTVLMQALVSRGECPLqLLKITAIAT---TSAYFIKKTGKMLTSFAETMNLPFSFNIVEVSDFSAIKE 403
                    ***************************************96554499*******...58999********************************** PP

           GRAS 192 eeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvEr 287
                    + L+v+++E++aV   ++  +l     +l+++ d+v+k++++++P v+v++e ea+hns++F++rf+eal +ysa fd+l+a + r++++r+ +E 
  Jcr4S02617.40 404 NLLEVDKEETIAVYAEFMPRSLI----ALPNRLDSVMKMIRNVNPCVMVFAEVEANHNSPTFVNRFIEALFFYSAYFDCLDACFERDDQNRMIMES 495
                    *****************877776....88888899************************************************************* PP

           GRAS 288 ellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                    +++g+ i+n +a+eg+er+ r+ +le Wr+ + ++G+++ +ls++   qa+l+++k++ +d  +++++ +slv+gWk+ pL s+SaW+
  Jcr4S02617.40 496 MYFGKGIRNTIAAEGEERIIRNVKLEVWRMFFARFGMEETELSSSSLFQAELVIKKFSfGDSCMLDKDGKSLVFGWKGTPLHSLSAWK 583
                    **********************************************************9999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.28186562IPR005202Transcription factor GRAS
PfamPF035143.1E-90215583IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 585 aa     Download sequence    Send to blast
MFPFQTSNYD DSNYSTFQDK FSLTNVSFYS LDVENINTKG SFYGVEERGE SAGVDTISSV  60
NGLYQDNIWK QELPIPKYEQ QEQKQQSFSD YEQFDDLRFP ILSSQLQTCN GIEEVGPEKE  120
KACPFSSLQL LKSHSNGFKQ FSSGRVIEPS NYTHYSSNKA VDEGLSTEQI MRIAGSRFIQ  180
SAGQEVDVGF SFNHPFDSFS GLSDEDTKMV ELAISLLASA ENIGNQQFDR AGRLLKQCDL  240
FASNIGNPVQ RVVYYFVEAL RERIDKETGK TTLKGLGKKQ SFDIDEAMMT PNLAVMASHQ  300
LMPFGQIAQF AGIQAIEENV GNAKRIHIID LAIRNGIQWT VLMQALVSRG ECPLQLLKIT  360
AIATTSAYFI KKTGKMLTSF AETMNLPFSF NIVEVSDFSA IKENLLEVDK EETIAVYAEF  420
MPRSLIALPN RLDSVMKMIR NVNPCVMVFA EVEANHNSPT FVNRFIEALF FYSAYFDCLD  480
ACFERDDQNR MIMESMYFGK GIRNTIAAEG EERIIRNVKL EVWRMFFARF GMEETELSSS  540
SLFQAELVIK KFSFGDSCML DKDGKSLVFG WKGTPLHSLS AWKFR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-3424258333375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM4052920.0KM405292.1 Jatropha curcas GRAS41 protein (GRAS41) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012082630.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLA0A067JYC80.0A0A067JYC8_JATCU; GRAS41 protein
STRINGPOPTR_0010s15370.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.12e-56RGA-like 2
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]